DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and dhrs1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001002205.1 Gene:dhrs1 / 368670 ZFINID:ZDB-GENE-030616-591 Length:310 Species:Danio rerio


Alignment Length:263 Identity:68/263 - (25%)
Similarity:113/263 - (42%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCV 71
            |:|....:||||||||:.|||:.:..||.:.:..:..:       ::...|.|:.:.||:..|.|
Zfish     3 LSGWICVVTGASRGIGRGIALQLSEAGATVYITGRQEK-------SLKQTAAEVAERGGRCLPVV 60

  Fly    72 VDVRDEQQVRSAVEAAVAKFGG-IDIVINNASA---ISLTNTP----DTDMKRYDLMHNINTRGT 128
            .|...|:.::...|....:..| :||::|||.|   ..|.|..    :.|...:|.::|...||.
Zfish    61 CDSSKEEDIKELFERVEREQNGRLDILVNNAYAGVQAILDNVSKKFWEVDPGIWDTINNTGLRGH 125

  Fly   129 FLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            :..|......:.......|:.||   ||....:..:|.|.:.|.........|..|.|..|::..
Zfish   126 YFCSVYAARLMVAQGKGLIVVIS---SMGGLRYLFNVPYGVGKAACDRMAADMGIELKKRGVASV 187

  Fly   194 ALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYA-ILTR-EPRQSTGQFFVDDEVLESAGIT 256
            :||| .|:.|..|:.....|..    .|..  |:.|. :.|. |..:.:|:..|  |:.:..|:.
Zfish   188 SLWP-GAVQTETIKQYMSQDEG----PPGF--DSKYKDVFTNGETTELSGRCIV--ELAKDKGLM 243

  Fly   257 DLT 259
            .:|
Zfish   244 SMT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 64/247 (26%)
PRK08278 7..277 CDD:181349 68/263 (26%)
SCP2 317..406 CDD:280250
dhrs1NP_001002205.1 PRK08303 1..267 CDD:236229 68/263 (26%)
DHRS1-like_SDR_c 3..268 CDD:187664 68/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.