DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and ZK697.14

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001024318.1 Gene:ZK697.14 / 3565013 WormBaseID:WBGene00022809 Length:249 Species:Caenorhabditis elegans


Alignment Length:212 Identity:51/212 - (24%)
Similarity:94/212 - (44%) Gaps:32/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGG---KAY 68
            :|.|::.||||:||||..:..:..::....:|.|....|         |.|:|:.....   :.:
 Worm     1 MAPRSILITGANRGIGLGLVKQFLKNEGIQLVIATCRNP---------SKADELNSIADSRLQIF 56

  Fly    69 PCVVDVRDE-QQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTR--GTFL 130
            |..:|..|. :::...|:..|.. .|:.::||||:..|:... :..:.|..:...|.|.  .|.:
 Worm    57 PLEIDCDDSIKKLYENVDTLVGT-DGLTVLINNAAICSVYEI-EGQISRTYMRQQIETNSVSTAI 119

  Fly   131 VSKVCLPYLKK-----------SNHAHILNISPPLS----MKPKWFGPHVAYTMAKYGMSMCVLG 180
            :::..:|.|||           ::.|.|:|||...:    :..|..|.::||.|:|..::.....
 Worm   120 LTQNFIPLLKKASAKNGGEEYSTDRAAIVNISSGAASIGYIDDKQPGIYIAYRMSKSALNSFSKS 184

  Fly   181 MAAEFKDEGISVNALWP 197
            .:.|.....|.|.|:.|
 Worm   185 CSVELAKYHILVTAMCP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 51/212 (24%)
PRK08278 7..277 CDD:181349 51/212 (24%)
SCP2 317..406 CDD:280250
ZK697.14NP_001024318.1 carb_red_sniffer_like_SDR_c 6..248 CDD:187586 49/207 (24%)
adh_short 6..211 CDD:278532 49/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.