DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG40486

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:89/216 - (41%) Gaps:54/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAE---------PHPKLPGTIYSAAEEIEKAGG 65
            |...:||||.|||..:|......|..:|..|:..:         | |:|.|.::           
  Fly     7 RVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQLP-PELQGRLH----------- 59

  Fly    66 KAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFL 130
             |..|  ||.|...|.:|.:....:.||.||::|||..::.......::::...:.|:|..|..:
  Fly    60 -AIHC--DVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQLLTLELEQLQQVLNVNLMGVVI 121

  Fly   131 VSKVCLPYLKK---SNHAHILN-------ISPP------LSMKPKWFGPHVAYTMAKYGMSMCVL 179
            .::.....:::   ..|..::|       |:||      |:|          |.:.|:|::..:.
  Fly   122 CTRRAFRSMQQREVDGHVILINSLTGRNIINPPGDELQVLNM----------YPLTKHGVTAMLE 176

  Fly   180 GMAAE---FKDEGISVNALWP 197
            .:..|   ||.: |.|.::.|
  Fly   177 VLRQELRGFKTK-IKVTSITP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 49/216 (23%)
PRK08278 7..277 CDD:181349 49/216 (23%)
SCP2 317..406 CDD:280250
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 49/216 (23%)
NADB_Rossmann 1..242 CDD:304358 49/216 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.