DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG31937

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:113/269 - (42%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 INTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGK 66
            ::...:.|:.::|||||.|||:.:||..||.|..:|::|:..|...::.....:||..: .|...
  Fly    39 VSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGL-LATKD 102

  Fly    67 AYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLV 131
            .....:|:.|..:.::.:...:..|..:|:::|||......:..:.:::....:..::......:
  Fly   103 VLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHL 167

  Fly   132 SKVCLPYLKKSN--HAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNA 194
            |::.:.|..:.|  ..||...|......|..|.|  .|..||:.::..:|.:..|.:...:|:.|
  Fly   168 SRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSP--TYCAAKHALNAYLLSLKVEMRKLDVSLFA 230

  Fly   195 LWPRTAIHTAAI-EMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVDDEVLESAGITDL 258
            ..|   |.|..: |..||....|            ..:.|...::.|.|...|...:..|...||
  Fly   231 PGP---IATDFLQEAFTGSQGGK------------VGLSTANQKRMTAQRCGDLFAVALANKMDL 280

  Fly   259 TEYACFREN 267
            |....|..|
  Fly   281 TWCGLFPVN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 53/242 (22%)
PRK08278 7..277 CDD:181349 60/264 (23%)
SCP2 317..406 CDD:280250
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/264 (23%)
adh_short 47..245 CDD:278532 46/203 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.