DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG9360

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:62/244 - (25%)
Similarity:101/244 - (41%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVVDV 74
            |...:||||.|||..........|..:|..|:..:...:|..::  .|::..:..|:  .|  ||
  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKASL--PADQASRFHGR--KC--DV 65

  Fly    75 RDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDL--MHNINTRGTFLVSKVCLP 137
            ..||:|..|.....|..||.|:::|||..:.|......:....||  :.:.|..|....::....
  Fly    66 SQEQEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFK 130

  Fly   138 YLKKS--NHAHILNI----------SPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDE-- 188
            .||:.  |..|||.:          :|.::|.        .|:.:||.::.....:..||.:.  
  Fly   131 SLKRRNVNDGHILIVNSVAGHRVINNPGITMG--------MYSPSKYAVTALTEVLRQEFHNNKT 187

  Fly   189 GISVNALWPRTAIHTAAI--EMLTG-PDSAKWSRKPEIMADA-AYAILT 233
            ...:.::.| .|:.|..|  |.|.| ||..  ..:.|.:||| :|.|.|
  Fly   188 QTKITSISP-GAVDTEIIDKEALVGIPDFP--MLRSEDVADAISYCIQT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 62/244 (25%)
PRK08278 7..277 CDD:181349 62/244 (25%)
SCP2 317..406 CDD:280250
CG9360NP_572746.1 YdfG 1..250 CDD:226674 62/244 (25%)
NADB_Rossmann 1..246 CDD:304358 62/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.