DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and antdh

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:94/240 - (39%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAA----KTAEPHPKLPGTIYSAAEEIEKAGGKAYPC 70
            |...:||||.|||..||......|..:|..|    :..|...:||.         ||. ||.:..
  Fly     7 RVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPA---------EKR-GKLFAL 61

  Fly    71 VVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVC 135
            ..||.:|..|..|.:..:.|.|.||:::|||..:......|.:......:...|..|..|.::..
  Fly    62 YCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRA 126

  Fly   136 LPYLKKSN-HAHILNISPPLSMK----PKWFGPHV-AYTMAKYGMSMCVLGMAAEFKDEGISVNA 194
            :..:::.. ..|::.|:..|..|    .:...|.| .|..:|:.::....|...||...|..:..
  Fly   127 VRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKI 191

  Fly   195 LWPRTAIHTAAIEMLTGPDSAKWSRK------PEIMADAAYAILT 233
                |::....::....|||.:.:.|      .:|.....|||.|
  Fly   192 ----TSVSPGVVDTEIVPDSIREAIKDRMLHSEDIAQGVLYAIAT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 58/240 (24%)
PRK08278 7..277 CDD:181349 58/240 (24%)
SCP2 317..406 CDD:280250
antdhNP_572695.2 YdfG 1..250 CDD:226674 58/240 (24%)
NADB_Rossmann 1..245 CDD:304358 58/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.