DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and DHRS4L2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_932349.2 Gene:DHRS4L2 / 317749 HGNCID:19731 Length:232 Species:Homo sapiens


Alignment Length:222 Identity:52/222 - (23%)
Similarity:93/222 - (41%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGG 65
            |.....|..:...:|.::.|||..||.:.|:|.|::||:::..:       .:..|...::..|.
Human    24 MTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQ-------NVDQAVATLQGEGL 81

  Fly    66 KAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNT-PDTDMKRYDLMHNINTRGTF 129
            .....|..|...:.....|..||...|||||:::||:......: .|...:.:|...:||.:...
Human    82 SVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPA 146

  Fly   130 LVSKVCLPYLKKSNHAHILNISPPLSMKPK-WFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            |::|..:|.::|.....::.:|...:..|. .|.|:.....|..|::..   :|.|.....|.||
Human   147 LMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNT---LAIELAPRNIRVN 208

  Fly   194 ALWPRTAIHTAAIEMLTGPDSAKWSRK 220
            .|      | ..:..|.....:.|:||
Human   209 CL------H-LDLSRLASAGCSGWTRK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 51/218 (23%)
PRK08278 7..277 CDD:181349 51/216 (24%)
SCP2 317..406 CDD:280250
DHRS4L2NP_932349.2 NADB_Rossmann 24..>210 CDD:304358 46/195 (24%)
adh_short 33..210 CDD:278532 44/186 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.