DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG13377

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:272 Identity:56/272 - (20%)
Similarity:102/272 - (37%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEI-----EK 62
            |......|.:.||.|...:|.::....|..|..:....|.|:  ..||..:.....:|     |.
  Fly    39 NADSHPSRVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQ--DSLPAKLLCGWMKIREYSEEP 101

  Fly    63 AGGKAYPCVVDVRDEQQVRSAVEAAVAKFG----GIDIVINNASAISLTNTPDTDMKRYDLMHNI 123
            ..|...|..:||..|..:|.|.....|...    ||..|||.:.::........::::::.|...
  Fly   102 IAGTIIPMRLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHMLRT 166

  Fly   124 NTRGTFLVSKVCLPYLK--KSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFK 186
            |..||..|:|..:.:|:  :....::..:|...:.:.:..| .||:..::..:..|...:..|..
  Fly   167 NILGTLRVAKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDG-LVAFNASRVAVDKCAEELRKELH 230

  Fly   187 DEGISVNAL----WPRTAIHTAAI----EMLTG-----------PDS------AKWSRKPEIMAD 226
            ..|:||.||    ....:::.|.:    .::.|           ||:      |.|...|:    
  Fly   231 PYGVSVVALDTCGMTAESLYKAPVAQTMSLVVGAPTQYTADVLSPDALHVIERALWDYVPQ---- 291

  Fly   227 AAYAILTREPRQ 238
            ..||:|:....|
  Fly   292 QRYALLSHNKYQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 55/270 (20%)
PRK08278 7..277 CDD:181349 55/268 (21%)
SCP2 317..406 CDD:280250
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 44/202 (22%)
NADB_Rossmann 46..>237 CDD:304358 41/193 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.