DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Stoml1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:133 Identity:47/133 - (35%)
Similarity:67/133 - (50%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 NEAAAEDAAAPASGGDVKIPQ------LFRKIESLLSPEIVSKTQAVFQFNI---SGAEQGTWFL 341
            ||  .|..|:.|..|....|:      |...::..||..:||:..|.:|||:   ||. |..:||
  Rat   269 NE--VEPPASRAGAGTEPSPKQPVAEGLLTALQPFLSESLVSQVGACYQFNVLLPSGT-QSIYFL 330

  Fly   342 DLKNGSGSCGAGTPTAAPDATLTMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALKLEKLMK 406
            ||..|.|..|.|.|...||..:.|...:...:...:|:...|||:|:||:.||....:|||.::|
  Rat   331 DLTTGQGRVGHGVPDGIPDVVVEMAEADLQALLCKELRPLGAYMSGRLKVKGDLAVVMKLEAVLK 395

  Fly   407 ALK 409
            |||
  Rat   396 ALK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959
PRK08278 7..277 CDD:181349
SCP2 317..406 CDD:280250 33/91 (36%)
Stoml1NP_001292167.1 PHB 77..217 CDD:214581
SPFH_SLP-1 94..224 CDD:259814
SCP2 304..395 CDD:280250 33/91 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.