DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsdl2 and Stoml1

DIOPT Version :10

Sequence 1:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:133 Identity:47/133 - (35%)
Similarity:67/133 - (50%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 NEAAAEDAAAPASGGDVKIPQ------LFRKIESLLSPEIVSKTQAVFQFNI---SGAEQGTWFL 341
            ||  .|..|:.|..|....|:      |...::..||..:||:..|.:|||:   ||. |..:||
  Rat   269 NE--VEPPASRAGAGTEPSPKQPVAEGLLTALQPFLSESLVSQVGACYQFNVLLPSGT-QSIYFL 330

  Fly   342 DLKNGSGSCGAGTPTAAPDATLTMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALKLEKLMK 406
            ||..|.|..|.|.|...||..:.|...:...:...:|:...|||:|:||:.||....:|||.::|
  Rat   331 DLTTGQGRVGHGVPDGIPDVVVEMAEADLQALLCKELRPLGAYMSGRLKVKGDLAVVMKLEAVLK 395

  Fly   407 ALK 409
            |||
  Rat   396 ALK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349
SCP2 306..408 CDD:442486 37/110 (34%)
Stoml1NP_001292167.1 SPFH_SLP-1 94..224 CDD:259814
SCP2 311..395 CDD:460423 31/84 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.