Sequence 1: | NP_651578.1 | Gene: | CG5590 / 43325 | FlyBaseID: | FBgn0039537 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_695227.2 | Gene: | Dhrs4 / 266686 | RGDID: | 708482 | Length: | 279 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 51/206 - (24%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 38/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAG-----GK 66
Fly 67 AYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAIS--LTNTPDTDMKRYDLMHNINTRGTF 129
Fly 130 LVSKVCLPYLKKSNHAHILNIS--------PPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFK 186
Fly 187 DEGISVNALWP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5590 | NP_651578.1 | FabG | 5..245 | CDD:223959 | 51/206 (25%) |
PRK08278 | 7..277 | CDD:181349 | 51/206 (25%) | ||
SCP2 | 317..406 | CDD:280250 | |||
Dhrs4 | NP_695227.2 | CR_SDR_c | 24..279 | CDD:187641 | 51/206 (25%) |
Microbody targeting signal | 277..279 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |