DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Dhrs4

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_695227.2 Gene:Dhrs4 / 266686 RGDID:708482 Length:279 Species:Rattus norvegicus


Alignment Length:206 Identity:51/206 - (24%)
Similarity:93/206 - (45%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAG-----GK 66
            ||.:...:|.::.|||..||.:.|.|||::|::::..:...:...|:  ..|.:...|     ||
  Rat    31 LANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATL--QGEGLSVTGVVCHVGK 93

  Fly    67 AYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAIS--LTNTPDTDMKRYDLMHNINTRGTF 129
            |       .|.:::   |..|:....||||:::|| |::  ..|..|...:.::.:.:||...:.
  Rat    94 A-------EDREKL---VNMALKLHQGIDILVSNA-AVNPFFGNLMDVTEEVWNKVLSINVTASA 147

  Fly   130 LVSKVCLPYLKKSNHAHILNIS--------PPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFK 186
            ::.|..:|.::|.....::.:|        |.|       ||   |.::|..:.......|||..
  Rat   148 MMIKAVVPAMEKRGGGSVVIVSSVAGFVLFPSL-------GP---YNVSKTALLGLTKNFAAELA 202

  Fly   187 DEGISVNALWP 197
            .:.|.||.|.|
  Rat   203 PKNIRVNCLAP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 51/206 (25%)
PRK08278 7..277 CDD:181349 51/206 (25%)
SCP2 317..406 CDD:280250
Dhrs4NP_695227.2 CR_SDR_c 24..279 CDD:187641 51/206 (25%)
Microbody targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.