DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and DECR2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_065715.1 Gene:DECR2 / 26063 HGNCID:2754 Length:292 Species:Homo sapiens


Alignment Length:275 Identity:76/275 - (27%)
Similarity:120/275 - (43%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCV 71
            |..:..||||...|||..||....|.|.:.|:|:::      ||..:.:|.:.....|.:..|..
Human    26 LRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRS------LPRVLTAARKLAGATGRRCLPLS 84

  Fly    72 VDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVCL 136
            :|||....|.:||:.|:.:||.|||:||.|:...|..........:..:.:|:|.|||.||:|..
Human    85 MDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLY 149

  Fly   137 PYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPRTAI 201
            ....:.:...|:||:..|..:.:....|..  .||..:......:|.|:..:.|.||:|.|....
Human   150 EKFFRDHGGVIVNITATLGNRGQALQVHAG--SAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPIS 212

  Fly   202 HTAAIEMLTGPDSA-----------KWSRKPEIMADAAYAIL-TREPRQS--TGQFFVDDE---V 249
            .|..:..|.||.::           :...|.||    |:::| ...|..|  ||...|.|.   :
Human   213 GTEGLRRLGGPQASLSTKVTASPLQRLGNKTEI----AHSVLYLASPLASYVTGAVLVADGGAWL 273

  Fly   250 LESAGITDLTEYACF 264
            ....|:..|.::|.|
Human   274 TFPNGVKGLPDFASF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 70/251 (28%)
PRK08278 7..277 CDD:181349 76/275 (28%)
SCP2 317..406 CDD:280250
DECR2NP_065715.1 TER_DECR_SDR_a 26..273 CDD:187627 72/258 (28%)
Substrate binding 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.