DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Scp2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_035457.1 Gene:Scp2 / 20280 MGIID:98254 Length:547 Species:Mus musculus


Alignment Length:140 Identity:48/140 - (34%)
Similarity:74/140 - (52%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 EAAA-----EDAAAPAS--GGDVKIPQLFRKIESLLSPE---IVSKTQAVFQFNIS---GAEQGT 338
            |||:     :.:|||.|  |...|...:|::||..|..|   .|.|...:|.|.:.   |.::.|
Mouse   409 EAASSFRTHQVSAAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEAT 473

  Fly   339 WFLDLKNGSGSCGAGTPTAAPDATLTMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALKLEK 403
            |.:|:|||.||....:...| |.|:||...:...:.:||:....|:..|||||:|:...|:||:.
Mouse   474 WVVDVKNGKGSVLPNSDKKA-DCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQN 537

  Fly   404 L-MKALKSKL 412
            | ::..|:||
Mouse   538 LQLQPGKAKL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959
PRK08278 7..277 CDD:181349
SCP2 317..406 CDD:280250 32/95 (34%)
Scp2NP_035457.1 PRK08256 12..404 CDD:181327
nondecarbox_cond_enzymes 17..403 CDD:238422
SCP2 452..538 CDD:280250 30/86 (35%)
Microbody targeting signal. /evidence=ECO:0000255, ECO:0000303|PubMed:26901662 545..547 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.