DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and T01G6.10

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_503224.2 Gene:T01G6.10 / 187966 WormBaseID:WBGene00020154 Length:275 Species:Caenorhabditis elegans


Alignment Length:207 Identity:53/207 - (25%)
Similarity:98/207 - (47%) Gaps:34/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGT------IYSAAEEIEKAG 64
            :.:|:::.:||:|.|||:..|:..|:.||.:.:..:.|   .||..|      :....|.:    
 Worm     3 RFSGKSVIVTGSSSGIGRATAVLFAKYGAQVTITGRDA---GKLEATKKKMLKVMKNPENV---- 60

  Fly    65 GKAYPCVV--DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRG 127
                 |||  ::.|.......|::|:..||.||:::|||.|..:..|.:||... :|.|.     
 Worm    61 -----CVVVANLTDSDGQDEIVQSALDAFGRIDVLVNNAGANVVDGTFNTDQST-ELYHK----- 114

  Fly   128 TFLVS-KVCLPYLKKS-NH-----AHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEF 185
            ||.:: :..:..:||: ||     ..|:|:| .::..|:...|...|..:|..:......:|.:.
 Worm   115 TFQINFEAVIEMVKKTKNHLIESKGEIVNVS-SVAAGPQALAPSPYYAASKAALDQYTRCVALDL 178

  Fly   186 KDEGISVNALWP 197
            ..:|:.||::.|
 Worm   179 ILQGVRVNSVSP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 53/207 (26%)
PRK08278 7..277 CDD:181349 53/206 (26%)
SCP2 317..406 CDD:280250
T01G6.10NP_503224.2 FabG 3..259 CDD:223959 53/207 (26%)
NADB_Rossmann 4..263 CDD:304358 53/206 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.