Sequence 1: | NP_651578.1 | Gene: | CG5590 / 43325 | FlyBaseID: | FBgn0039537 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503224.2 | Gene: | T01G6.10 / 187966 | WormBaseID: | WBGene00020154 | Length: | 275 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 53/207 - (25%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 34/207 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGT------IYSAAEEIEKAG 64
Fly 65 GKAYPCVV--DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRG 127
Fly 128 TFLVS-KVCLPYLKKS-NH-----AHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEF 185
Fly 186 KDEGISVNALWP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5590 | NP_651578.1 | FabG | 5..245 | CDD:223959 | 53/207 (26%) |
PRK08278 | 7..277 | CDD:181349 | 53/206 (26%) | ||
SCP2 | 317..406 | CDD:280250 | |||
T01G6.10 | NP_503224.2 | FabG | 3..259 | CDD:223959 | 53/207 (26%) |
NADB_Rossmann | 4..263 | CDD:304358 | 53/206 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |