DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and F59E11.2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_505327.2 Gene:F59E11.2 / 186621 WormBaseID:WBGene00019109 Length:321 Species:Caenorhabditis elegans


Alignment Length:280 Identity:65/280 - (23%)
Similarity:109/280 - (38%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPK----LPGTIYSAAEEIEKAGGKA 67
            |..:...:||||||||:.|||:....||.:.:..:..|....    ||...| .|:||...|||.
 Worm     5 LQDQVALVTGASRGIGRGIALQLGEAGATVYITGRRPELSDNFRLGLPSLDY-VAKEITSRGGKG 68

  Fly    68 YPCVVDVRDEQQVRSAVEAAVA-KFGGIDIVINN-----ASAISLTNTP--DTDMKRYDLMHNIN 124
            ....||..:..:|:...|.... :.|.:||::||     ..|..:....  |.|...:|.::.:.
 Worm    69 IALYVDHSNMTEVKFLFEKIKEDEEGKLDILVNNVYNSLGKATEMIGKTFFDQDPSFWDDINGVG 133

  Fly   125 TRGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEG 189
            .|..:..|......:.:.....|:|:.....:|   :..:|||...|..::.....||.|.....
 Worm   134 LRNHYYCSVYAARMMVERRKGLIVNVGSLGGLK---YVFNVAYGAGKEALARMSTDMAVELNPYN 195

  Fly   190 ISVNALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPR-------QST------- 240
            :.|             :.::.||...:.:.:..|  |.||.::...|.       :||       
 Worm   196 VCV-------------VTLIPGPVKTETANRTII--DDAYKMIKENPELEEFIKGESTEYTGKAL 245

  Fly   241 GQFFVDDEVLESAGITDLTE 260
            .:..:|...|:.:|.|..||
 Worm   246 ARLAMDPGKLKKSGKTLFTE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 59/263 (22%)
PRK08278 7..277 CDD:181349 65/280 (23%)
SCP2 317..406 CDD:280250
F59E11.2NP_505327.2 PRK08303 5..281 CDD:236229 65/280 (23%)
NADB_Rossmann 5..278 CDD:304358 65/280 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.