DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and F25D1.5

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_505704.1 Gene:F25D1.5 / 184922 WormBaseID:WBGene00009110 Length:277 Species:Caenorhabditis elegans


Alignment Length:273 Identity:63/273 - (23%)
Similarity:118/273 - (43%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAG---GKA 67
            :.:|:::.|||:|.|||:..|:..|::||.:.:..:..:       .:....::|.|||   .|.
 Worm     3 RFSGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNED-------RLEETKQQILKAGVPAEKI 60

  Fly    68 YPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTD--MKRYDLMHNINTRGTFL 130
            ...|.||.:.......:...:||||.|||::|||.|.....|.:||  ::.|.....:|.:....
 Worm    61 NAVVADVTEASGQDDIINTTLAKFGKIDILVNNAGANLADGTANTDQPVELYQKTFKLNFQAVIE 125

  Fly   131 VSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNAL 195
            :::....:|.|:. ..|:|:| .:...|:....:..|..||..:.......|.:....|:.||::
 Worm   126 MTQKTKEHLIKTK-GEIVNVS-SIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSV 188

  Fly   196 WPRTAIHTAAIEMLTGPDSAK-------WSR----------KPEIMADAAYAILTREPRQSTGQF 243
            .| .|:.|..:..:..|::|.       .||          |||.:|:....:..|    :...:
 Worm   189 SP-GAVATGFMGAMGLPETASDKLYSFIGSRKECIPVGHCGKPEEIANIIVFLADR----NLSSY 248

  Fly   244 FVDDEVLESAGIT 256
            .:...::...|.|
 Worm   249 IIGQSIVADGGST 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 61/260 (23%)
PRK08278 7..277 CDD:181349 63/272 (23%)
SCP2 317..406 CDD:280250
F25D1.5NP_505704.1 FabG 3..259 CDD:223959 61/269 (23%)
SDR_c11 4..263 CDD:187622 63/272 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.