DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and C06E4.6

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_501154.1 Gene:C06E4.6 / 182329 WormBaseID:WBGene00015535 Length:274 Species:Caenorhabditis elegans


Alignment Length:280 Identity:78/280 - (27%)
Similarity:115/280 - (41%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKA- 67
            |.|:|    .|||:|.|||:..|:..|.|||.:.:..:.|       ..:....:.|.|||..| 
 Worm     5 TDKVA----IITGSSNGIGRATAVLLATDGAKVTITGRDA-------ARLEETRQAILKAGISAT 58

  Fly    68 --YPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDT--------DMKRYDLMHN 122
              ...|.||...:.....:.:.:.|||.|:|:||||.|    |.||:        .::....|..
 Worm    59 NVNSVVADVTTAEGQDLLISSTLDKFGKINILINNAGA----NIPDSQGQTRTKCSIENLTKMFQ 119

  Fly   123 INTRGTF-LVSKVCLPYLKKSNHAHILNIS--------PPLSMKPKWFGPHVAYTMAKYGMSMCV 178
            :|.:... :|.|| .|:|.|: ...|:|||        .|.|       |:  |:.||..:....
 Worm   120 LNLQSVVEMVQKV-RPHLAKT-RGEIVNISSIGAGPAAQPAS-------PY--YSSAKAALDQYS 173

  Fly   179 LGMAAEFKDEGISVNALWP---RTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQST 240
            ...|.:...|||.:|.:.|   .|...||| ..|:..:|.|:.   ::|....:.|    |....
 Worm   174 RCAAIDLISEGIRINVVQPGFVSTGFSTAA-RGLSADESVKFY---DLMGSLPHCI----PAGYC 230

  Fly   241 GQ---------FFVDDEVLE 251
            ||         |.||.:|.|
 Worm   231 GQPDHLASVIAFLVDRKVSE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 73/271 (27%)
PRK08278 7..277 CDD:181349 76/277 (27%)
SCP2 317..406 CDD:280250
C06E4.6NP_501154.1 FabG 3..262 CDD:223959 78/280 (28%)
NADB_Rossmann 4..266 CDD:304358 78/280 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.