DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and dhs-26

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_508580.2 Gene:dhs-26 / 180624 WormBaseID:WBGene00000989 Length:321 Species:Caenorhabditis elegans


Alignment Length:339 Identity:83/339 - (24%)
Similarity:131/339 - (38%) Gaps:80/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVA----AKTAEPH----PKLPGTIYSAAEEIEKA 63
            |..:...:||||||.|:.:||:.|..|..:.:.    :||....    |.|.||    |||..|.
 Worm     3 LKSKIAIVTGASRGCGRGVALQLAEAGCTLYITGRAPSKTLSSELTYLPTLEGT----AEECRKR 63

  Fly    64 GGKAYPCVVDVRDEQQVRSAV-EAAVAKFGGIDIVINNA-SAISLTNTPDT------DMKRYDLM 120
            ||..:...||..:..:|.... |.|......:||::||| ||::...:.||      |.:.:|.:
 Worm    64 GGICHVRYVDHSNMDEVEKFFDEVASETDNQLDILVNNAFSAVTKCGSGDTRKFFERDPEIWDDI 128

  Fly   121 HNINTRGTFLVSKVCLPYLKKSN-HAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAE 184
            :|:..|..:..|......::|:. ...|:|||   |:....:...|||.:.|..:......||.|
 Worm   129 NNVGLRNQYYCSVYGTRIMRKNGMKGLIVNIS---SLGGIMYLFTVAYGVGKMALDRMSSDMAQE 190

  Fly   185 FKDEGISVNALWPRTAIHTAAIEMLTGPDSAKW----------SRKPEIMADAAYAILTREPRQS 239
            .:|.||:|.:||| :|:.|..|..:....:..|          ....|....|..|| ..:|::.
 Worm   191 LQDTGITVISLWP-SAVKTELITNMIETSAGSWGATENKMFLNGESTEYCGKAVVAI-AADPKKK 253

  Fly   240 --TGQFFVDDEVLESAGITDLTEYACFRENADKLMVDFFVEEKGAPVENEAAAEDAAAPASGGDV 302
              .|...:         .||:..|..:.:.                                 |.
 Worm   254 YWNGSTLI---------TTDMGNYYSYTDI---------------------------------DG 276

  Fly   303 KIPQLFRKIESLLS 316
            :||...|::..|||
 Worm   277 RIPTNMRQLRGLLS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 73/266 (27%)
PRK08278 7..277 CDD:181349 76/298 (26%)
SCP2 317..406 CDD:280250 83/339 (24%)
dhs-26NP_508580.2 PRK08303 1..286 CDD:236229 80/333 (24%)
DHRS1-like_SDR_c 3..278 CDD:187664 77/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.