Sequence 1: | NP_651578.1 | Gene: | CG5590 / 43325 | FlyBaseID: | FBgn0039537 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506413.1 | Gene: | F53C11.3 / 179872 | WormBaseID: | WBGene00009973 | Length: | 313 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 93/199 - (46%) | Gaps: | 18/199 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 GKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKA-GGKAY 68
Fly 69 PCVVDVRDEQQVRSAVEAAVAKFGGI-DIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVS 132
Fly 133 ----KVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
Fly 194 ALWP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5590 | NP_651578.1 | FabG | 5..245 | CDD:223959 | 55/199 (28%) |
PRK08278 | 7..277 | CDD:181349 | 54/197 (27%) | ||
SCP2 | 317..406 | CDD:280250 | |||
F53C11.3 | NP_506413.1 | TER_DECR_SDR_a | 40..275 | CDD:187627 | 48/181 (27%) |
PRK07677 | 40..273 | CDD:181077 | 48/181 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |