DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and dhs-9

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_498146.1 Gene:dhs-9 / 175737 WormBaseID:WBGene00000973 Length:319 Species:Caenorhabditis elegans


Alignment Length:280 Identity:71/280 - (25%)
Similarity:131/280 - (46%) Gaps:36/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTI-----YSAAEEIEKAGGK 66
            |||:...:||||||||:.|||:....||.:.:..:  :|...|...:     .:.|:||.|.|||
 Worm     3 LAGQIAIVTGASRGIGRGIALQLGEAGATVYITGR--KPEESLNSKVGLSGLEATADEITKRGGK 65

  Fly    67 AYPCVVDVRDEQQVRSAVEAAVAKF-GGIDIVINNA----SAISLT-NTP--DTDMKRYDLMHNI 123
            .....||.::.::|::..|....:. |.:||::|||    :|||.. ..|  :||...:|.::|:
 Worm    66 GIARFVDHQNMEEVKNFFEVVEKEHQGQLDILVNNAYQGVTAISENMGKPFYETDPYVWDTINNV 130

  Fly   124 NTRGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDE 188
            ..|..:..:......:...|...|:|:|....::..:   :|||.:.|..:.......|.|.:.:
 Worm   131 GLRNHYFCTVYAARLMTARNKGLIVNVSSGGGLRYLF---NVAYGVGKQALDRMSADTAVELRKK 192

  Fly   189 GISVNALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYA-------------ILTREPRQ-- 238
            .:.|.::|| .|:.|..::.:...::.|  .:|||.....:|             .|..:||:  
 Worm   193 NVCVVSIWP-GAVRTELVDKMFKDENGK--PRPEIKNAEVFANGETVEYPGRAVVSLASDPRRMD 254

  Fly   239 STGQFFVDDEVLESAGITDL 258
            .||:..:.:::.:..|..|:
 Worm   255 KTGRILITEDLGKEYGFVDI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 69/265 (26%)
PRK08278 7..277 CDD:181349 71/280 (25%)
SCP2 317..406 CDD:280250
dhs-9NP_498146.1 PRK08303 1..279 CDD:236229 71/280 (25%)
NADB_Rossmann 3..276 CDD:304358 71/280 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.