DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and decr-1.3

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_495714.1 Gene:decr-1.3 / 174316 WormBaseID:WBGene00011467 Length:309 Species:Caenorhabditis elegans


Alignment Length:251 Identity:69/251 - (27%)
Similarity:106/251 - (42%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEK-AG 64
            ::..|.|.|:...:||...||||.||...|..||::.:||:..|   ||..|    ||||.| .|
 Worm    17 ILRDGALKGKVALVTGGGTGIGKAIATTFAHLGASVAIAARRME---KLEQT----AEEIMKTTG 74

  Fly    65 GKAYPCVVDVRDEQQVRSAVEAAVAKFG-GIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGT 128
            |...|..:|::|...|....:....||| ..||::|||:...:..|.......:..:.:|..:||
 Worm    75 GICEPFRMDIKDPGMVSDTFDKIDKKFGKHPDILVNNAAGNFIMATERLSPNAHGTIIDIVLKGT 139

  Fly   129 FLVS----KVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEG 189
            ..|:    |.|   ::....|.:.:|:...:.....|  .|...::|.|:.:....:|.|:...|
 Worm   140 MNVTTELGKRC---IQSKTGASVTSITAAYARSGAPF--IVPSAVSKAGVEIMTKSLATEWSKYG 199

  Fly   190 ISVNALWPRTAIHTAAIEMLTGPDSAK--WSR--KPEIMADAAYAILTREPRQSTG 241
            :..||:.|             ||...|  |.|  ..| |.|.|..:....|...:|
 Worm   200 LRFNAVSP-------------GPIPTKGAWGRLFSGE-MGDVAEKMKELNPEGRSG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 69/247 (28%)
PRK08278 7..277 CDD:181349 68/245 (28%)
SCP2 317..406 CDD:280250
decr-1.3NP_495714.1 TER_DECR_SDR_a 23..274 CDD:187627 68/245 (28%)
PRK07677 25..272 CDD:181077 67/243 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.