DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsdl2 and maoc-1

DIOPT Version :10

Sequence 1:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_495494.1 Gene:maoc-1 / 174181 WormBaseID:WBGene00017123 Length:298 Species:Caenorhabditis elegans


Alignment Length:70 Identity:18/70 - (25%)
Similarity:30/70 - (42%) Gaps:18/70 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 FLDLKNGSGSCG-----------AGTPTAAPDATL----TMNSKNFFDMFSGKLKAAPAYMTGKL 389
            |...:.|||:.|           |..|..||||.:    |::....:.:.||.:.  |.::..:.
 Worm   134 FSTFQTGSGNFGGDRTSPHEIKAATVPDRAPDAVIEQKTTVDQAALYRLGSGDMN--PLHVDPEF 196

  Fly   390 -KISG 393
             |:||
 Worm   197 AKMSG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349
SCP2 306..408 CDD:442486 18/70 (26%)
maoc-1NP_495494.1 PLN02864 2..282 CDD:178455 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.