DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Y47G6A.21

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 / 171924 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans


Alignment Length:258 Identity:66/258 - (25%)
Similarity:112/258 - (43%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYS----AAEEIEKAGGKAYPCVVDV 74
            |||||.||||..||..|:....:.:..:..:...::.....|    :|::|       ....|::
 Worm     6 ITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCISEGAISADDI-------LITAVEL 63

  Fly    75 RDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVCLPYL 139
            ..::..::.|:|.|.|||.||.:||:|..:......|:.::.||.:.|:|.|....:::..||::
 Worm    64 SSDEAPKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHI 128

  Fly   140 --KKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPR---T 199
              .|....::.:|:.|..     |.....|.|:|..:......:|.|....|:.|||:.|.   |
 Worm   129 ITTKGTVVNVSSINGPCP-----FAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVT 188

  Fly   200 AIHTAAIEMLTGPDSAKWSR------------KPEIMADAAYAILTREPRQS---TGQFFVDD 247
            .||.|     :|.|.|.::.            :|...::.|.|||.....:|   |||....|
 Worm   189 NIHRA-----SGQDEATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTGQLLKVD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 65/254 (26%)
PRK08278 7..277 CDD:181349 66/258 (26%)
SCP2 317..406 CDD:280250
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 66/258 (26%)
NADB_Rossmann 3..252 CDD:304358 66/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.