DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and DECR1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:199 Identity:51/199 - (25%)
Similarity:87/199 - (43%) Gaps:11/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEI-EKAG 64
            |:......|:..||||...|:||.:....:..||..|:|::..:       .:.:.||:| .:.|
Human    51 MLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMD-------VLKATAEQISSQTG 108

  Fly    65 GKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGT- 128
            .|.:....||||...|::.|...:...|..:||||||:...::.|.......:..:.:|...|| 
Human   109 NKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTA 173

  Fly   129 FLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            |:..::....:|....|..|:|:...:.....|  .|....||.|:......:|||:...|:..|
Human   174 FVTLEIGKQLIKAQKGAAFLSITTIYAETGSGF--VVPSASAKAGVEAMSKSLAAEWGKYGMRFN 236

  Fly   194 ALWP 197
            .:.|
Human   237 VIQP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 50/195 (26%)
PRK08278 7..277 CDD:181349 50/193 (26%)
SCP2 317..406 CDD:280250
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 50/193 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.