DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and DHRS1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001129522.1 Gene:DHRS1 / 115817 HGNCID:16445 Length:313 Species:Homo sapiens


Alignment Length:313 Identity:79/313 - (25%)
Similarity:133/313 - (42%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVVD 73
            |:...:||||||||:.|||:..:.||.:.:..:..:       |:...|:|.:..||:..|.|.|
Human     7 GQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLD-------TLRVVAQEAQSLGGQCVPVVCD 64

  Fly    74 VRDEQQVRSAVEAA-VAKFGGIDIVINNASA--ISLTNTP-----DTDMKRYDLMHNINTRGTFL 130
            ...|.:|||..|.. ..:.|.:|:::|||.|  .::.||.     :|....:|.::|:..||.:.
Human    65 SSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYF 129

  Fly   131 VSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNAL 195
            .|......:..:....|:.||.|.|::..:   :|.|.:.|..........|.|.:..|:|..:|
Human   130 CSVYGARLMVPAGQGLIVVISSPGSLQYMF---NVPYGVGKAACDKLAADCAHELRRHGVSCVSL 191

  Fly   196 WP---RTAI---HTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFV----DDEVL 250
            ||   :|.:   |.|..|:|..|          ::.....|..:.|..:.:|:..|    |..:|
Human   192 WPGIVQTELLKEHMAKEEVLQDP----------VLKQFKSAFSSAETTELSGKCVVALATDPNIL 246

  Fly   251 ESAG----ITDLTEYACFRENADKLMVDFFVEEKGAPVENEAAAEDAAAPASG 299
            ..:|    ..||......|:      ||      |.||::..:.....:..||
Human   247 SLSGKVLPSCDLARRYGLRD------VD------GRPVQDYLSLSSVLSHVSG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 65/249 (26%)
PRK08278 7..277 CDD:181349 74/289 (26%)
SCP2 317..406 CDD:280250
DHRS1NP_001129522.1 PRK08303 1..271 CDD:236229 75/295 (25%)
DHRS1-like_SDR_c 5..271 CDD:187664 75/295 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.