DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and DHRS4

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens


Alignment Length:262 Identity:64/262 - (24%)
Similarity:106/262 - (40%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGG 65
            |.....||.:...:|.::.|||..||.:.|:|||::||:::..:       .:..|...::..|.
Human    24 MTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQ-------NVDQAVATLQGEGL 81

  Fly    66 KAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNT-PDTDMKRYDLMHNINTRGTF 129
            .....|..|...:.....|..||...|||||:::||:......: .|...:.:|...:||.:...
Human    82 SVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPA 146

  Fly   130 LVSKVCLPYLKKSNHAHILNISPPLSMKPK-WFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            |::|..:|.::|.....::.:|...:..|. .|.|   |.::|..:......:|.|.....|.||
Human   147 LMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSP---YNVSKTALLGLTKTLAIELAPRNIRVN 208

  Fly   194 ALWPRTAIHTAAIEMLTGPDSAKW--SRKPEIMADAAYAILTREPRQSTG--QFFVDDEVLESAG 254
            .|.| ..|.|:...||       |  ..|.|.|.:........||....|  .|...::.....|
Human   209 CLAP-GLIKTSFSRML-------WMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITG 265

  Fly   255 IT 256
            .|
Human   266 ET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 61/245 (25%)
PRK08278 7..277 CDD:181349 63/256 (25%)
SCP2 317..406 CDD:280250
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 64/262 (24%)
fabG 30..273 CDD:235975 63/256 (25%)
Microbody targeting signal 276..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.