DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and AT3G25600

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_189188.4 Gene:AT3G25600 / 822147 AraportID:AT3G25600 Length:161 Species:Arabidopsis thaliana


Alignment Length:146 Identity:32/146 - (21%)
Similarity:67/146 - (45%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRN-EKKIKLDE-- 65
            |..:::.::.:|.......:| :..::|...||:|.:.|....|..|.....|| ...::.||  
plant     6 PTDQIKQLKDIFARFDMDKDGSLTQLELAALLRSLGIKPRGDQISLLLNQIDRNGNGSVEFDELV 70

  Fly    66 --FLP-IYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFAD 127
              .|| |..:|...:||     .:|..:.:|::.||::..|||..::..:|..|...::..:..:
plant    71 VAILPDINEEVLINQEQ-----LMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMMTE 130

  Fly   128 CMDPEDDEGFIPYSQF 143
            .  ..:.:|.|.:::|
plant   131 A--DSNGDGVISFNEF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 32/146 (22%)
EFh 84..148 CDD:298682 12/60 (20%)
AT3G25600NP_189188.4 PTZ00184 1..148 CDD:185504 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.