DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and Myl4

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:153 Identity:59/153 - (38%)
Similarity:82/153 - (53%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVPKREVENVEFVFEVMGSPGEG---IDAVDLGDALRALNLNPTLALIEKLGGTKK---RNEKKI 61
            |....::|..:..|.:......|   |.....||.||||..|||.|.:.::.|..|   .|.|.:
  Rat    43 DFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTL 107

  Fly    62 KLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFA 126
            ..:.||||...:.:.||||.||||:|.|:::|||.|||::.|||:|.|..|||.:.:.:||.|..
  Rat   108 DFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLT 172

  Fly   127 DCMDPEDDEGFIPYSQFVQRLMS 149
               ..||..|.|.|..||:.:||
  Rat   173 ---GQEDANGCINYEAFVKHVMS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 57/151 (38%)
EFh 84..148 CDD:298682 28/63 (44%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 56/149 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6207
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.