DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and cmlc1

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_571767.2 Gene:cmlc1 / 64671 ZFINID:ZDB-GENE-030522-1 Length:196 Species:Danio rerio


Alignment Length:153 Identity:54/153 - (35%)
Similarity:85/153 - (55%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVPKREVENVEFVFEVMGSPGEG---IDAVDLGDALRALNLNPTLA-LIEKLGGTK--KRNEKKI 61
            |....::|.....|.:......|   |.....||.:|||..|||.| ::..||..|  :.|.|.:
Zfish    46 DFSPDQIEEFRDAFTLFDETPTGEMKIRYAQCGDVMRALGHNPTNADVLTVLGKPKAEEMNTKYL 110

  Fly    62 KLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFA 126
            ..:.|||:...:.:.|:||.:|||:|.|:::|||.|||::.|||:|.|..|||.:.:::|:.|.|
Zfish   111 DFETFLPMLQHISRAKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEDEVDRLMA 175

  Fly   127 DCMDPEDDEGFIPYSQFVQRLMS 149
               ..||..|.|.|:.|::.::|
Zfish   176 ---GQEDANGCINYTSFIKHILS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 53/151 (35%)
EFh 84..148 CDD:298682 27/63 (43%)
cmlc1NP_571767.2 EFh_PEF 48..195 CDD:330173 52/149 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6866
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.