DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and myl4

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001020354.1 Gene:myl4 / 574004 ZFINID:ZDB-GENE-050626-112 Length:187 Species:Danio rerio


Alignment Length:121 Identity:52/121 - (42%)
Similarity:77/121 - (63%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDALRALNLNPTLALIEKLGG---TKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYD 93
            ||.:|||.||||.|.:.|:.|   .::.|.|.|..:.|||::..|.:.|:||.:|||:|.|:::|
Zfish    69 GDVMRALGLNPTNAEVLKVLGKPRPEEMNTKMIDFETFLPMFQHVSRSKDQGTFEDFVEGLRVFD 133

  Fly    94 KEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMS 149
            ||.|||::.|||:|.|..|||.:.:.:||.|.|   ..||..|.:.|..||:.:|:
Zfish   134 KEGNGTVMGAELRHVLATLGEKMTESEVEQLMA---GQEDGNGCVNYEAFVKHIMA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 51/119 (43%)
EFh 84..148 CDD:298682 28/63 (44%)
myl4NP_001020354.1 PTZ00184 39..186 CDD:185504 51/119 (43%)
EFh 124..185 CDD:238008 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6866
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.