DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and MYL3

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens


Alignment Length:121 Identity:53/121 - (43%)
Similarity:75/121 - (61%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDALRALNLNPTLALIEKLGGTKKR---NEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYD 93
            ||.||||..|||.|.:.::.|..::   |.|.:..:.|||:...:.|.|:.|.||||:|.|:::|
Human    77 GDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFD 141

  Fly    94 KEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMS 149
            ||.|||::.|||:|.|..|||.|.:::||.|.|   ..||..|.|.|..||:.:||
Human   142 KEGNGTVMGAELRHVLATLGERLTEDEVEKLMA---GQEDSNGCINYEAFVKHIMS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 51/119 (43%)
EFh 84..148 CDD:298682 30/63 (48%)
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 51/119 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6830
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.