DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and CG5024

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001163736.1 Gene:CG5024 / 43117 FlyBaseID:FBgn0039373 Length:165 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:58/125 - (46%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LGDALRALNLNPT-------LALIEKLGGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIEC 88
            |.|.|||:..||.       :..|:..|      ..::.|.:||.|.|  |:.:.....::.|..
  Fly    49 LRDCLRAVAHNPPENEIQDYITEIDTDG------SGELYLSDFLYIMS--KRYENLTVEDEVILA 105

  Fly    89 LKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLM 148
            .|::||:.:|.:...|.:..:...|:.::::::|.:..|.  ..:.|..|.|.:||..:|
  Fly   106 FKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDA--DANTELKIDYVRFVTMMM 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 30/125 (24%)
EFh 84..148 CDD:298682 14/63 (22%)
CG5024NP_001163736.1 PTZ00184 21..163 CDD:185504 29/123 (24%)
EFh 28..90 CDD:298682 13/46 (28%)
EFh 64..127 CDD:238008 14/70 (20%)
EFh 101..163 CDD:298682 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.