DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and myl6

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_989137.1 Gene:myl6 / 394742 XenbaseID:XB-GENE-5931386 Length:151 Species:Xenopus tropicalis


Alignment Length:153 Identity:53/153 - (34%)
Similarity:89/153 - (58%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVPKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIK-- 62
            |.|....::.:.:..|::....|:| |.....||.:|||..|||.|.:.|:.|..|..:..||  
 Frog     1 MCDYSDDQIADYKESFQLFDRVGDGKILFGQCGDVMRALGQNPTNAEVMKVLGNPKPEDMNIKTL 65

  Fly    63 -LDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFA 126
             .::|||:...|.|.::....||.||.|:::|||.|||::.:||:|.|::|||.:.|::||||.:
 Frog    66 DFEQFLPMMQTVAKNRDVPGLEDIIEGLRVFDKEGNGTVMGSELRHVLVSLGEKMTDDEVETLLS 130

  Fly   127 DCMDPEDDEGFIPYSQFVQRLMS 149
               :.||..|.|.|.:.::.:::
 Frog   131 ---NHEDANGCINYEELIRAILN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 53/151 (35%)
EFh 84..148 CDD:298682 27/63 (43%)
myl6NP_989137.1 EFh_PEF 5..146 CDD:330173 51/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6696
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.