DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and myl13

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_956810.1 Gene:myl13 / 393488 ZFINID:ZDB-GENE-040426-1593 Length:186 Species:Danio rerio


Alignment Length:167 Identity:57/167 - (34%)
Similarity:89/167 - (53%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKREVE------NVEFVFEVMGSPGEGIDAVD-------------LGDALRALNLNPTLALIEKL 50
            |.:|.|      .:||..|.:....:.....|             .||.:|||..|||.|.:..:
Zfish    22 PPKEPEFNAAEVQIEFTAEQIEDFKDAFQLFDRTPTNEMKITFAQCGDLIRALGQNPTNAEVLHV 86

  Fly    51 GGTKKRNEKKIKL---DEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLAL 112
            .|..|..:.::|:   |:|||::..:.|.|::|.:|||:|.|:::|||.|||::.|||:|.|..|
Zfish    87 LGKPKPEDMQVKMLDFDQFLPMHQHICKAKDRGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATL 151

  Fly   113 GESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMS 149
            ||.:.:::||.|.|   ..||..|.|.|..||:.:|:
Zfish   152 GEKMKEDEVEQLMA---GQEDANGCINYEAFVKHIMA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 56/165 (34%)
EFh 84..148 CDD:298682 29/63 (46%)
myl13NP_956810.1 PTZ00184 34..185 CDD:185504 53/153 (35%)
EFh 123..184 CDD:238008 29/63 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6866
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.