DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and CG13898

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:141 Identity:35/141 - (24%)
Similarity:68/141 - (48%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLG-GTKKRNEKKIKLDEFLPIY 70
            :::::...||:......| |.|.|||:.:|.|..|.|.:.|.:.. |.:......|:|.:|:.:.
  Fly    12 DLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDLM 76

  Fly    71 SQVKKEKEQGCYEDFIE-CLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLF--ADCMDPE 132
            :::......   .|::: ....:|.:::|.:...||:|..:.|||.:.||:...:|  ||.    
  Fly    77 TKIYSAMGS---SDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADV---- 134

  Fly   133 DDEGFIPYSQF 143
            |.:|.|.:..|
  Fly   135 DGDGVINFRDF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 35/141 (25%)
EFh 84..148 CDD:298682 18/63 (29%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 35/141 (25%)
EFh 18..77 CDD:298682 17/58 (29%)
EFh 88..148 CDD:238008 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.