DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and Myl6l

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001094453.2 Gene:Myl6l / 362816 RGDID:1305620 Length:151 Species:Rattus norvegicus


Alignment Length:153 Identity:57/153 - (37%)
Similarity:90/153 - (58%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVPKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKL- 63
            |.|..:.:....:..|::....|:| |.....||.:|||..|||.|.:.|:.|..|.:|..:|: 
  Rat     1 MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVL 65

  Fly    64 --DEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFA 126
              :.|||:...|.|.|:||.|||::|.|:::|||.|||::.||::|.|:.|||.:.:|:||.|.|
  Rat    66 DFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVA 130

  Fly   127 DCMDPEDDEGFIPYSQFVQRLMS 149
               ..||..|.|.|.:.|:.:::
  Rat   131 ---GHEDSNGCINYEELVRMVLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 57/151 (38%)
EFh 84..148 CDD:298682 27/63 (43%)
Myl6lNP_001094453.2 PTZ00184 5..149 CDD:185504 55/146 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6207
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.