DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and zgc:153867

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_017209013.1 Gene:zgc:153867 / 337226 ZFINID:ZDB-GENE-030131-9170 Length:209 Species:Danio rerio


Alignment Length:152 Identity:58/152 - (38%)
Similarity:88/152 - (57%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADVPKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKK---RNEKKIK 62
            :|..:.::...:..|.:....|:| |.....||.:|||..||..|.:.|:.|..|   .|.|.:.
Zfish    60 SDFSEDQILEFKEAFLLFDRTGDGKITYNQCGDVMRALGQNPVNAEVLKVLGNPKAEEMNHKLLD 124

  Fly    63 LDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFAD 127
            .::|||:...:.|.|:||.:|||:|.|:::|||.|||::.|||:|.|..|||.:.:|:||||.| 
Zfish   125 FEQFLPMLQAIAKNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVETLLA- 188

  Fly   128 CMDPEDDEGFIPYSQFVQRLMS 149
              ..||..|.|.|.:.|:.:||
Zfish   189 --GHEDANGCINYEELVRMVMS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 56/150 (37%)
EFh 84..148 CDD:298682 30/63 (48%)
zgc:153867XP_017209013.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6866
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.