DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and myl1

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_956294.1 Gene:myl1 / 336165 ZFINID:ZDB-GENE-030131-8109 Length:190 Species:Danio rerio


Alignment Length:151 Identity:45/151 - (29%)
Similarity:81/151 - (53%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVPKREVENVEFVFEVMGSPGEGIDAVD-LGDALRALNLNPTLALIEKLGGTKKRNE---KKIKL 63
            |..:.::|:....|.:....|:...|.: :.|.:|||..|||...:.|:.|....::   |::..
Zfish    42 DFTQDQMEDYREAFLLFDRVGDSKVAYNQIADIMRALGQNPTNKEVTKILGNPTADDMVNKRVDF 106

  Fly    64 DEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADC 128
            :.|||:...|.....:..|:|::|.|:::|||.|||::.|||:..|..|||.:.:.:::.|.   
Zfish   107 EGFLPMLQVVINNPNKATYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMSEAEIDALM--- 168

  Fly   129 MDPEDDEGFIPYSQFVQRLMS 149
            ...||:.|.:.|..||:.:||
Zfish   169 QGQEDENGCVNYEAFVKHIMS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 43/149 (29%)
EFh 84..148 CDD:298682 23/63 (37%)
myl1NP_956294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
FRQ1 43..189 CDD:227455 42/148 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I6866
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.