DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and CG34435

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:79/185 - (42%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVPKREVENVEFVF-----------EVMGSP-----GEGIDAVDLGDALRALNLNPT------ 43
            :.::||  :.|:..:|           |.:.:|     |.||...|:.|.||.:.|||:      
  Fly    26 LPEIPK--LRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDDELQQ 88

  Fly    44 -----LALIEKLGGTKKRNEKKIKLDEFLPIYSQVK----KEKEQGC-YEDFIECLKLYDKEENG 98
                 :...|.||...|:..::...:..|.:|.|:.    ||..:|| .|:.:..|:..|....|
  Fly    89 RLEEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTG 153

  Fly    99 TMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLM-SDPV 152
            .:..::|:|.|..:|..||:.:|   :.......|..|.:.|...|.:|. :||:
  Fly   154 MLPYSQLRHLLTTMGNRLDETEV---YGVLHRAADINGNVLYEHLVHQLFATDPL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 43/180 (24%)
EFh 84..148 CDD:298682 14/63 (22%)
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 44/183 (24%)
FRQ1 <188..297 CDD:227455 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.