DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and RGD1559821

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006249352.1 Gene:RGD1559821 / 304447 RGDID:1559821 Length:151 Species:Rattus norvegicus


Alignment Length:153 Identity:53/153 - (34%)
Similarity:85/153 - (55%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVPKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKL- 63
            |.|..:.:....:..|::....|.| |.....||.:|||..|||...:.|:.|..|.:|..::: 
  Rat     1 MCDFTEDQTTEFKEAFQLFDRTGNGKILYSQCGDVMRALGQNPTNTEVLKVLGNPKSDEMNVEVL 65

  Fly    64 --DEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFA 126
              :.|||:...|.|.|:||.|||::|.|.::|||.|..:|.||::|.|:.|||::.:|:||.|.|
  Rat    66 DFEHFLPMLQTVAKSKDQGTYEDYVEGLHVFDKEGNSAVLGAEIRHILVTLGENMTEEEVEMLVA 130

  Fly   127 DCMDPEDDEGFIPYSQFVQRLMS 149
               ..||....|.|.:.|:.:::
  Rat   131 ---GHEDSNSCINYEELVRMVLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 53/151 (35%)
EFh 84..148 CDD:298682 25/63 (40%)
RGD1559821XP_006249352.1 PTZ00184 5..149 CDD:185504 51/146 (35%)
EFh 11..75 CDD:298682 19/63 (30%)
EFh 11..39 CDD:197492 7/27 (26%)
EFh 94..148 CDD:298682 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.