DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and Cabp5

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_038905.1 Gene:Cabp5 / 29865 MGIID:1352746 Length:173 Species:Mus musculus


Alignment Length:149 Identity:35/149 - (23%)
Similarity:70/149 - (46%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRN-EKKIKLDEFLPIY 70
            |::.:...|.......:| |...|||:.:|.:...||...:.:||...:.| ..::..::|:.:.
Mouse    29 ELDELREAFLEFDKDQDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDFVELM 93

  Fly    71 SQVKKEKEQGC--YEDFIECLKLYDKEENGTMLLAELQHAL-LALGESLDDEQVETLFADCMDPE 132
            :.....:..|.  .::..:..|.:|...:|.:.|||||.|: ..|||.|...::    |:.:...
Mouse    94 TPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREI----AEVVQEA 154

  Fly   133 D--DEGFIPYSQFVQRLMS 149
            |  .:|.:.:.:|| ::||
Mouse   155 DINGDGTVDFEEFV-KMMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 33/147 (22%)
EFh 84..148 CDD:298682 18/66 (27%)
Cabp5NP_038905.1 PTZ00184 25..171 CDD:185504 33/146 (23%)
EFh 32..94 CDD:238008 13/61 (21%)
EFh 109..172 CDD:238008 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.