DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and cdc4

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_594947.1 Gene:cdc4 / 2541699 PomBaseID:SPAP8A3.08 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:42/149 - (28%)
Similarity:77/149 - (51%) Gaps:13/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVPKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKLDEF 66
            |.|.::      .|.:....|.| |....:||.|||...|||||.|.::..|.   ..::.:::|
pombe     5 DSPYKQ------AFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTL---PAEVDMEQF 60

  Fly    67 LPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDP 131
            |.:.::.......|..|:|::..:::||:..|.:.:.||::.|.:|||.|.:|:::.|....  |
pombe    61 LQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGV--P 123

  Fly   132 EDDEGFIPYSQFVQRLMSD 150
            ..| |.:.|..|||.::::
pombe   124 VKD-GMVNYHDFVQMILAN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 42/146 (29%)
EFh 84..148 CDD:298682 20/63 (32%)
cdc4NP_594947.1 PTZ00184 8..141 CDD:185504 40/144 (28%)
EF-hand_6 8..36 CDD:290141 9/33 (27%)
EFh 78..138 CDD:238008 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.