DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and Myl3

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001351413.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:121 Identity:53/121 - (43%)
Similarity:75/121 - (61%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDALRALNLNPTLALIEKLGGTKKR---NEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYD 93
            ||.||||..|||.|.:.::.|..|:   |.|.:..:.|||:...:.|.|:.|.||||:|.|:::|
Mouse    86 GDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFD 150

  Fly    94 KEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMS 149
            ||.|||::.|||:|.|..|||.|.:::||.|.|   ..||..|.|.|..||:.:|:
Mouse   151 KEGNGTVMGAELRHVLATLGERLTEDEVEKLMA---GQEDSNGCINYEAFVKHIMA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 52/119 (44%)
EFh 84..148 CDD:298682 30/63 (48%)
Myl3NP_001351413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
EFh_PEF 53..203 CDD:330173 52/119 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6299
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.