DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and mlc-7

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001022669.1 Gene:mlc-7 / 176811 WormBaseID:WBGene00023451 Length:153 Species:Caenorhabditis elegans


Alignment Length:148 Identity:49/148 - (33%)
Similarity:80/148 - (54%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNE-KKIKLDEFLP 68
            :|.::.|..||....:.|:| ||:..|..||||:.||||.||:.::  :|.|.. .:|.::||:|
 Worm     4 QRLMDEVHDVFHFHDTLGDGKIDSKQLPTALRAMMLNPTEALLAEV--SKARTSGARITVEEFIP 66

  Fly    69 IYSQVKKEKEQGC-----YEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADC 128
            ||.:|    |..|     .::|...|..:|:|.||.::|.||:..|...||.:.:::|:.|.   
 Worm    67 IYKKV----EAACGRSTTLKEFQTLLSHFDREGNGQIMLMELKSMLQNGGEKMTNQEVDNLL--- 124

  Fly   129 MDPEDDEGFIPYSQFVQR 146
            ...|..:|.|..:.|:.|
 Worm   125 FGVEVVDGRININNFLNR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 49/148 (33%)
EFh 84..148 CDD:298682 19/63 (30%)
mlc-7NP_001022669.1 FRQ1 8..139 CDD:227455 46/139 (33%)
EFh 9..65 CDD:298682 22/57 (39%)
EF-hand_8 55..109 CDD:290545 18/57 (32%)
EFh 83..140 CDD:298682 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D575783at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.