DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and mlc-5

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_499813.1 Gene:mlc-5 / 176796 WormBaseID:WBGene00011734 Length:142 Species:Caenorhabditis elegans


Alignment Length:136 Identity:55/136 - (40%)
Similarity:77/136 - (56%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VFEVMGSPG-EGIDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKLDEFLPIYSQVKKEKE 78
            ||....|.| |.|....:||.||||..|||.|.|.|..|:..| |.::..::|:||:..|.|.:|
 Worm    10 VFAYFDSKGDERISVQQVGDVLRALGQNPTEAEIHKCVGSFDR-EARLSFEDFVPIFQSVSKNRE 73

  Fly    79 QGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQF 143
            :...|:|:|.|..:|||.||.:.:|||:|.|..|||.|.||.|:.|.:   ...|..|.:..|.|
 Worm    74 KHTVEEFVEGLSHFDKEGNGMINVAELRHLLTTLGERLSDEDVDQLLS---GHNDSHGNVNISDF 135

  Fly   144 VQRLMS 149
            |:.:|:
 Worm   136 VRAVMN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 54/134 (40%)
EFh 84..148 CDD:298682 26/63 (41%)
mlc-5NP_499813.1 PTZ00184 2..140 CDD:185504 54/133 (41%)
EFh 6..62 CDD:298682 21/52 (40%)
EFh 79..140 CDD:238008 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.