DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and mlc-3

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_741145.1 Gene:mlc-3 / 175768 WormBaseID:WBGene00003371 Length:153 Species:Caenorhabditis elegans


Alignment Length:150 Identity:61/150 - (40%)
Similarity:93/150 - (62%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGT--KKRNEKKIKLDEF 66
            |.::|  ::.:|.:.....:| ||...:||..||..|.||.|::.|..|.  |::.||::..:|:
 Worm     4 PSQDV--LKEIFNLYDEELDGKIDGTQVGDVARAAGLKPTQAMVTKAAGQEFKRKGEKRLTFEEW 66

  Fly    67 LPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDP 131
            ||:|.|:.||||||.|.||.|.||::||||.|.:|.|||:|.||||||.|..::.:.|....   
 Worm    67 LPMYEQLAKEKEQGTYADFYEGLKVFDKEETGKILAAELRHILLALGERLSADEADELLKGV--- 128

  Fly   132 EDDEGFIPYSQFVQRLMSDP 151
            ||.||.:.|..|::::::.|
 Worm   129 EDGEGMVKYEDFIKKVLAGP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 60/146 (41%)
EFh 84..148 CDD:298682 29/63 (46%)
mlc-3NP_741145.1 EF-hand_7 9..70 CDD:290234 20/60 (33%)
EFh 90..142 CDD:298682 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45863
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113380
Panther 1 1.100 - - LDO PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.