DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc1 and MYL6B

DIOPT Version :9

Sequence 1:NP_001287569.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001186558.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:148 Identity:56/148 - (37%)
Similarity:87/148 - (58%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KREVENVEFVFEVMGSPGEG-IDAVDLGDALRALNLNPTLALIEKLGGTKKRNE---KKIKLDEF 66
            |.::|..:..||:....|:| |.....||.:|||..|||.|.:.|:.|..|.:|   :::..:.|
Human    63 KDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETF 127

  Fly    67 LPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDP 131
            ||:...|.|.:.||.|||::|..:::|||.||.::.|||:|.|..|||.:.:|:|||:.|   ..
Human   128 LPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLA---GH 189

  Fly   132 EDDEGFIPYSQFVQRLMS 149
            ||..|.|.|..|::.::|
Human   190 EDSNGCINYEAFLKHILS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc1NP_001287569.1 PTZ00184 1..149 CDD:185504 55/146 (38%)
EFh 84..148 CDD:298682 26/63 (41%)
MYL6BNP_001186558.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 55/146 (38%)
EFh 68..132 CDD:298682 21/63 (33%)
EFh 68..96 CDD:197492 8/27 (30%)
EFh 150..205 CDD:238008 24/57 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6830
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.