DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and RPS10A

DIOPT Version :9

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_014936.1 Gene:RPS10A / 854468 SGDID:S000005819 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:55/104 - (52%)
Similarity:74/104 - (71%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRHF 65
            |.:||.:|..|::|||:|||:|||||....||.|:| ..||.|||.:|||.|:|:||.||:|:::
Yeast     1 MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEID-TKNLYVIKALQSLTSKGYVKTQFSWQYY 64

  Fly    66 YWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPR 104
            |:.||.||:|.||.||:||..|||.|..| .|:...||:
Yeast    65 YYTLTEEGVEYLREYLNLPEHIVPGTYIQ-ERNPTQRPQ 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 51/92 (55%)
RPS10ANP_014936.1 COG5045 1..105 CDD:227378 55/104 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343005
Domainoid 1 1.000 111 1.000 Domainoid score I1374
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H788
Inparanoid 1 1.050 115 1.000 Inparanoid score I1339
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53709
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - mtm9185
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.