DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and AT4G25740

DIOPT Version :10

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_194304.1 Gene:AT4G25740 / 828679 AraportID:AT4G25740 Length:177 Species:Arabidopsis thaliana


Alignment Length:173 Identity:82/173 - (47%)
Similarity:103/173 - (59%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRHF 65
            |.|.:.||..|.:|||||||..||||..:.||..:| :|||||||:|||..|:.:|:|.|||.|:
plant     1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETFAWMHY 64

  Fly    66 YWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFGGASKTD------DDR 124
            ||.|||||||.||.||:||.::||:||.::.:... ||.|||  ||....|..::|      .||
plant    65 YWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGG-RPFGGP--PGDRQRGPPRSDGDRPRFGDR 126

  Fly   125 SNYRRGPGAYGMDKKGDVGA--------GTGRVEYRGGFGRAS 159
            ..||.||  .|.|:||...|        |.|    |.||||.:
plant   127 DGYRGGP--RGGDEKGGAPADFQPSFQGGGG----RPGFGRGA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..95 CDD:427337 54/91 (59%)
AT4G25740NP_194304.1 S10_plectin 3..94 CDD:427337 54/91 (59%)

Return to query results.
Submit another query.