DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10a and RPS10

DIOPT Version :9

Sequence 1:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001005.1 Gene:RPS10 / 6204 HGNCID:10383 Length:165 Species:Homo sapiens


Alignment Length:164 Identity:94/164 - (57%)
Similarity:112/164 - (68%) Gaps:13/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSEL-DK-IPNLQVIKVMQSLNSRGWVKEQFAWR 63
            |.:||.||:||||.||||||:|||||..:.||.|| || :|||.|:|.||||.|||:||||||||
Human     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWR 65

  Fly    64 HFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFG----GASKTDDDR 124
            ||||.||||||:.||.||||||||||:||.::      ||..|...|.|..|    ..::.:.||
Human    66 HFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS------RPETGRPRPKGLEGERPARLTRGEADR 124

  Fly   125 SNYRRGPGAYGMDKKGDVGAGTG-RVEYRGGFGR 157
            ..|||.....|.|||.:.|||:. ..::||||||
Human   125 DTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 69/94 (73%)
RPS10NP_001005.1 S10_plectin 3..97 CDD:397530 69/93 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..165 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H788
Inparanoid 1 1.050 199 1.000 Inparanoid score I3794
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - mtm8512
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.