DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpS10a and PLEC

DIOPT Version :9

Sequence 1:	NP_651576.1	Gene:	RpS10a / 43321	FlyBaseID:	FBgn0027494	Length:	163	Species:	Drosophila melanogaster
Sequence 2:	XP_005251033.1	Gene:	PLEC / 5339	HGNCID:	9069	Length:	4689	Species:	Homo sapiens

Alignment Length:	141	Identity:	68/141 - (48%)
Similarity:	85/141 - (60%)	Gaps:	15/141 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKD-SPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRH 64
            |.:|:....||||.||:|||:||||| .|...|..:..:.||||::.|.||.:||.|:|.|||.|
Human     5 MLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRETFAWCH 69

  Fly    65 FYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNA-VRP----------RGGPGGPGGGFGGAS 118
            |||.||||||..||:||||||||||::|.:..|..| |.|          :|..|.|..  .|..
Human    70 FYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPK--RGPL 132

  Fly   119 KTDDDRSNYRR 129
            .|::.|. |||
Human   133 PTEEQRV-YRR 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpS10a	NP_651576.1	S10_plectin	3..96	CDD:281497	54/93 (58%)
PLEC	XP_005251033.1	S10_plectin	7..101	CDD:281497	54/93 (58%)
		CH	180..287	CDD:237981
		CH	302..400	CDD:278723
		SPEC	664..853	CDD:238103
		SPEC	760..949	CDD:238103
		SPEC	1244..1434	CDD:238103
		Myosin_tail_1	1485..2608	CDD:279860
		GBP_C	<1494..1621	CDD:303769
		coiled coil	1585..1596	CDD:293879
		coiled coil	1605..1621	CDD:293879
		ATP-synt_B	<1620..1740	CDD:304375
		SPEC	1868..2070	CDD:295325
		GBP_C	<2380..2507	CDD:303769
		coiled coil	2474..2487	CDD:293879
		coiled coil	2496..2507	CDD:293879
		Plectin	2833..2873	CDD:279071
		Plectin	2871..2911	CDD:279071
		PLEC	2908..2944	CDD:197605
		Plectin	2946..2987	CDD:279071
		Plectin	3162..3201	CDD:279071
		Plectin	3199..3239	CDD:279071
		PLEC	3236..3272	CDD:197605
		Plectin	3274..3314	CDD:279071
		PLEC	3492..3526	CDD:197605
		Plectin	3536..3570	CDD:279071
		PLEC	3567..3598	CDD:197605
		Plectin	3605..3646	CDD:279071
		Plectin	3827..3867	CDD:279071
		Plectin	3865..3905	CDD:279071
		PLEC	3902..3938	CDD:197605
		Plectin	3940..3981	CDD:279071
		Plectin	4069..4110	CDD:279071
		Plectin	4108..4148	CDD:279071
		Plectin	4183..4224	CDD:279071
		Plectin	<4285..4315	CDD:279071
		PLEC	4417..4450	CDD:197605
		Plectin	4452..4491	CDD:279071
		Plectin	4528..4569	CDD:279071
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5045
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810